Specialty Answering Service
- Android app
- Yes
- Free plan
- Trial only
- Paid plans from
- $44/mo
- Runs on
- Android, iOS, Web
Summary
Specialty Answering Service provides businesses with 24-hour live call answering, message taking, and call transfers. Accounts can use custom scripts and routing, including cold and warm transfers. After an operator completes a call, the system can send the message by text, email, or both. Its iPhone and Android app supports listening to calls, changing status, running reports, and texting callers; the service is also available on the web. Listed integrations include Salesforce, HubSpot, Google Calendar, Zendesk, Zoho, and Zapier. A Custom Action app can send call data to a software endpoint through a webhook. The company says its call center is SOC 2 certified and PCI and HIPAA compliant, and describes HIPAA-compliant call handling for medical practices; it can sign a Business Associate Agreement. Plans are billed monthly and can be changed or canceled at any time. The Economy plan is 44.00 USD per month plus $1.54 per minute. A free trial provides access to operators and software for two weeks or 200 minutes, without a credit card. Support is available by phone, email, social media, and live chat.
Who it is for
This service suits businesses that need live call coverage, message delivery, or call transfers, including medical practices seeking HIPAA-compliant call handling. Mobile users can listen to calls, update status, run reports, and text callers through the app.
What is good
- Provides 24-hour live answering.
- Supports customized scripts and call routing.
- Messages can be dispatched by text or email.
- Mobile app supports call listening and texting.
- Offers a two-week or 200-minute trial.
What to know first
- No free plan is listed.
- Economy costs 44.00 USD per month plus $1.54 per minute.
- Trial ends at two weeks or 200 minutes.
Verdict
Specialty Answering Service combines live operators with call routing, message delivery, mobile tools, and integrations. Its trial offers a way to evaluate the service, while ongoing use starts with a monthly fee plus per-minute charges.
Specialty Answering Service plans and pricing
All plansCompared on virtual receptionist services
- Free plan
- Nospecialtyansweringservice.net
- Paid from
- $44/mospecialtyansweringservice.net
- Answering mode
- humanspecialtyansweringservice.net
- Call qualification
- Yesspecialtyansweringservice.net
- Message taking
- Yesspecialtyansweringservice.net
- Call routing
- Yesspecialtyansweringservice.net
- Appointment scheduling
- Yesspecialtyansweringservice.net
- Multilingual answering
- Yesspecialtyansweringservice.net
Facts
- Service
- The company provides 24-hour live answering, message taking, and call transfer services for businesses.specialtyansweringservice.net · 3 Oct 2026
- Call handling
- Accounts can use customized call scripts and call routing, including cold and warm transfers.specialtyansweringservice.net · 3 Oct 2026
- Dispatch
- After an operator ends a call, the system can dispatch the message by text, email, or both.specialtyansweringservice.net · 3 Oct 2026
- Mobile app
- The iPhone and Android app supports listening to calls, updating status, running reports, and texting callers.specialtyansweringservice.net · 3 Oct 2026
- Integrations
- SAS Flex lists integrations including Salesforce, HubSpot, Google Calendar, Zendesk, Zoho, and Zapier.support.specialtyansweringservice.net · 3 Oct 2026
- Custom integration
- The Custom Action app can send call data to a software endpoint URL using a webhook.support.specialtyansweringservice.net · 3 Oct 2026
- Security
- The company states its call center is SOC 2 certified and PCI and HIPAA compliant, and says portal access is controlled by user privileges.support.specialtyansweringservice.net · 3 Oct 2026
- Healthcare
- The company says it can sign a Business Associate Agreement and describes HIPAA compliant call handling for medical practices.specialtyansweringservice.net · 3 Oct 2026
- Support
- The company offers phone, email, social media, and live chat support.specialtyansweringservice.net · 3 Oct 2026
- Trial terms
- The pricing page says the free trial provides access to operators and software for two weeks or 200 minutes without a credit card.specialtyansweringservice.net · 3 Oct 2026
- Plan flexibility
- The company says plans are billed monthly, have no long-term contract, and can be changed or canceled at any time.specialtyansweringservice.net · 3 Oct 2026
- Company history
- The company says it was founded in 1985 in the Philadelphia suburbs and lists its address in King of Prussia, Pennsylvania.specialtyansweringservice.net · 3 Oct 2026
Company
- Founded
- 1985specialtyansweringservice.net · 28 Sept 2026
- Headquarters
- King of Prussia, Pennsylvania, United Statesspecialtyansweringservice.net · 28 Sept 2026
Best Specialty Answering Service alternatives
See all 12
Where it ranks on Everything Xiaomi
Is Specialty Answering Service yours?
Claim it for free: prove the domain, then correct facts, plans and screenshots. An editor reviews every change.
Sources
- specialtyansweringservice.net/about/· checked 3 Oct 2026
- specialtyansweringservice.net/features/· checked 3 Oct 2026
- support.specialtyansweringservice.net/article/524-sas-flex-app-integrations· checked 3 Oct 2026
- support.specialtyansweringservice.net/article/368-post-message-data-to-webhoo· checked 3 Oct 2026
- support.specialtyansweringservice.net/article/58-are-my-messages-secure· checked 3 Oct 2026
- specialtyansweringservice.net/industries/healthcare/hipaa-compliant-a· checked 3 Oct 2026
- specialtyansweringservice.net/pricing/· checked 3 Oct 2026
- specialtyansweringservice.net· checked 28 Sept 2026